Nab2 Antibody [CoraFluor™ 1]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38193CL1

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Western Blot

Label

CoraFluor 1

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Nab2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Nab2 (NP_005958.1).

Sequence:
MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for Nab2 Antibody [CoraFluor™ 1]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark. Do not freeze.

Background: Nab2

Transcriptional control is in part regulated by interactions between DNA-bound transcription factors, such as Egr-1/NGFI-A, and coregulatory proteins, such as NAB (for NGFI-A-binding proteins). The evolutionarily conserved NAB proteins, NAB1 and NAB2, are corepressors of EGF-1/NGFI-A. Both NAB1 and NAB2 contain an amino terminal NAB conserved domain 1 (NCB1), which is required for binding NGFI-A, and a carboxy terminal NCD2 domain, which is responsible for the repressor function of NAB proteins. NAB2 is principally localized in the nucleus and may play a role in the downregulation of NGFI-A activity as well as in controlling fundamental processes such as cell division, differentiation and apoptosis. NAB2 has a predicted molecular mass of 56 kDa and localizes to chromosome 12q13.3-14.1, a region that is rearranged in several solid tumors, lipomas and liposarcomas.

Alternate Names

EGR-1-binding protein 2, MADEREGR1 binding protein 2, Melanoma-associated delayed early response protein, MGC75085, NGFI-A binding protein 2 (EGR1 binding protein 2), NGFI-A-binding protein 2, Protein MADER

Gene Symbol

NAB2

Additional Nab2 Products

Product Documents for Nab2 Antibody [CoraFluor™ 1]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Nab2 Antibody [CoraFluor™ 1]

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.