Skip to main content

NAALADase-2/NAALAD2 Antibody

Catalog # NBP2-87875 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-87875

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for NAALADase-2/NAALAD2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NAALADase-2/NAALAD2. Peptide sequence: HYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPPY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NAALADase-2/NAALAD2 Antibody

Western Blot: NAALADase-2/NAALAD2 Antibody [NBP2-87875] - Host: Rabbit. Target Name: NAALAD2. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for NAALADase-2/NAALAD2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAALADase-2/NAALAD2

The NAALAD2 gene is a member of the N-acetylated alpha-linked acidic dipeptidase (NAALADase) gene family. The representative member of this family is the gene encoding human prostate-specific membrane antigen (PSM), which is a marker of prostatic carcinomas and

Long Name

N-Acetylated Alpha-Linked Acidic Dipeptidase 2

Alternate Names

GCPIII, Glutamate Carboxypeptidase III, NAALAD2, NAALADase2

Gene Symbol

NAALAD2

Product Documents for NAALADase-2/NAALAD2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NAALADase-2/NAALAD2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...