MUL1 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59068
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
0.5 mg/ml
Product Specifications
Immunogen
Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 24709290).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for MUL1 Antibody - BSA Free
Western Blot: MUL1 Antibody [NBP1-59068]
Western Blot: MUL1 Antibody [NBP1-59068] - Human Heart lysate, concentration 0.2-1 ug/ml.Western Blot: MUL1 Antibody [NBP1-59068]
Western Blot: MUL1 Antibody [NBP1-59068] - Sample Tissue: Human Fetal Heart.Western Blot: MUL1 Antibody - BSA Free [NBP1-59068] -
Role of MUL1 on the anti-hypertrophic effects of E2 in NE-treated cardiomyocytes.NRVMs were treated with Ad MUL1 or Ad beta-GAL (control) with a MOI = 100 and incubated for 24 h. A MUL1 (N = 5) and B ANP (N = 5) protein levels were determined by western blotting. beta-tubulin was used as a loading control. C MUL1 (N = 4) and D ANP (N = 3) mRNA levels were assessed by RT-qPCR. 18S RNA was used to normalize the data. The data correspond to the mean +/- SEM. Results were analyzed using a one-way ANOVA test followed by multiple Tukey’s comparisons. *p < 0.05, **p < 0.01. E NRVMs were stained with rhodamine-phalloidin (red) and nuclei with DAPI (blue). Confocal images were obtained, and cell area was determined (N = 4). F MUL1 (N = 6) and G ANP (N = 6) mRNA levels were determined by RT-qPCR. 18S RNA was used to normalize the data. H NRVMs were stained with MTG (400 nM). Images were obtained by confocal microscopy and analyzed to determine the number of mitochondria per cell and the relative mitochondrial volume (N = 5). Scale bar = 20 μm. The values correspond to the mean +/- SEM. Each independent experiment is displayed as a dot in the graphs. Results were analyzed using 2-way ANOVA followed by multiple Tukey’s comparisons. *p < 0.05, **p < 0.01, ***p < 0.001, and ****p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39971924), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for MUL1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MUL1
Alternate Names
C1orf166mitochondrial E3 ubiquitin ligase 1, E3 ubiquitin-protein ligase MUL1, EC 6.3.2, EC 6.3.2.-, FLJ12875, GIDERP11-401M16.2, Growth inhibition and death E3 ligase, MAPLE3 ubiquitin ligase, mitochondrial E3 ubiquitin protein ligase 1, mitochondrial ubiquitin ligase activator of NF-kB, mitochondrial ubiquitin ligase activator of NFKB 1, Mitochondrial-anchored protein ligase, MULANchromosome 1 open reading frame 166, Putative NF-kappa-B-activating protein 266, RING finger protein 218, RNF218mitochondria-anchored protein ligase
Entrez Gene IDs
79594 (Human)
Gene Symbol
MUL1
Additional MUL1 Products
Product Documents for MUL1 Antibody - BSA Free
Product Specific Notices for MUL1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...