Skip to main content

MIA3 Antibody

Catalog # NBP2-34160 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-34160
NBP2-34160-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MIA3 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MIA3 Antibody

Immunocytochemistry/Immunofluorescence: MIA3 Antibody [NBP2-34160] - Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Analysis in human testis and skeletal muscle tissues unsing Anti-MIA3 antibody. Corresponding MIA3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Staining of human skeletal muscle shows low expression as expected.

Applications for MIA3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MIA3

Alternate Names

ARNT, C219 Reactive Peptide, C219-Reactive Peptide, D320, KIAA0268, Melanoma Inhibitory Activity Family, Member 3, Melanoma Inhibitory Activity Protein 3, TANGO, TANGO1, Transport And Golgi Organization, Transport And Golgi Organization Protein 1, UNQ6077

Gene Symbol

MIA3

UniProt

Product Documents for MIA3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MIA3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...