KDELR1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84117

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84117-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all KDELR1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KDELR1. Peptide sequence: RYLDLFTNYISLYNTCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KDELR1 Antibody - BSA Free

Western Blot: KDELR1 Antibody [NBP2-84117]

Western Blot: KDELR1 Antibody [NBP2-84117]

Western Blot: KDELR1 Antibody [NBP2-84117] - Host: Rabbit. Target Name: KDELR1. Sample Tissue: Human HT1080 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for KDELR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KDELR1

Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, which is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. The protein encoded by this gene was the first member of the family to be identified, and it encodes a protein structurally and functionally similar to the yeast ERD2 gene product. [provided by RefSeq]

Alternate Names

ER lumen protein retaining receptor 1, ERD2, ERD2.1KDEL receptor 1, HDEL, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 1, KDEL endoplasmic reticulum protein retention receptor 1, PM23, Putative MAPK-activating protein PM23

Gene Symbol

KDELR1

Additional KDELR1 Products

Product Documents for KDELR1 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KDELR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.