Skip to main content

Ikaros/IKZF1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-98314

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-98314

Key Product Details

Species Reactivity

Validated:

Mouse

Cited:

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen for this antibody is Ikzf1 - N-terminal region. Peptide sequence: RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ikaros/IKZF1 Antibody - BSA Free

Western Blot: Ikaros/IKZF1 Antibody [NBP1-98314]

Western Blot: Ikaros/IKZF1 Antibody [NBP1-98314]

Western Blot: Ikaros/IKZF1 Antibody [NBP1-98314] - Mouse Small Intestine Lysate 1.0ug/ml, Gel Concentration: 12%
Ikaros/IKZF1 Antibody - BSA Free

Western Blot: Ikaros/IKZF1 Antibody - BSA Free [NBP1-98314] -

LG100754 attenuates tumor growth and prolongs survival of mice injected with lenalidomide-resistant human MM cells. (A) Representative images of SCID mice with subcutaneous MM tumor. (B) Body weight was measured every 3 days and presented as means +/- SD. (C) LG100754 enhanced lenalidomide-induced attenuations of tumor growth in severe combined immunodeficient mice. (D) Overall survival was evaluated using Kaplan–Meier curve and long-rank analysis from the first day of tumor cell injection until death or occurrence of an event. (E) Tumors treated as above were analyzed by immunoblotting with indicated antibodies. (F) LG100754 reduced the blood glucose level and decrease lipid accumulation. (Left) Approximately 5 mg/kg LG100754 was injected intraperitoneally into mice. Blood glucose level was measured using glucose meter at indicated timepoint. (Right) Approximately 5 mg/kg LG100754 was injected intraperitoneally into mice. Total blood lipid was measured using lipid quantification kit. *: p < 0.05; **: p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37566072), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Ikaros/IKZF1 Antibody - BSA Free

Western Blot: Ikaros/IKZF1 Antibody - BSA Free [NBP1-98314] -

Increased CRBN expression is associated with synergistic effect of lenalidomide and RXR agonists. (A) U266 and MM1.R were treated with indicated concentrations of RXR agonists for 48 h. Protein lysate was subjected to Western blot with indicated antibodies. (B) Representative images of CRBN in MM cells treated with DMSO or 8 uM LG100754, 4 uM bexarotene, 4 uM AGN194204, and 4 uM LG101506 for 48 h. Bar graphs display the results of the mean intensity of CRBN immunofluorescence of two groups. (C) U266 and MM1.R were treated with 10 uM lenalidomide and RXR agonists at concentrations indicated in (B) for 48 h. CRBN, caspase 3, and caspase 9 expression was measured by Western blot. (D) MM1.R and U266 cells were transduced with CRBN-specific CRISP/cas9 knockout vector for 24 h. Cells were then treated with lenalidomide alone, LG100754 alone, or in combination for additional 48 h with or without transduction of CRBN overexpressing plasmid. Cell viability was measured by MTT assay. Results are presented as mean +/- SD from at least three separate experiments. NS: not statistically significant; *: p < 0.05; **: p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37566072), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Ikaros/IKZF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ikaros

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs)

Long Name

DNA-binding protein Ikaros

Alternate Names

IK1, IKZF1, LyF-1, LYF1, PRO0758, ZNFN1A1

Gene Symbol

IKZF1

Additional Ikaros Products

Product Documents for Ikaros/IKZF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ikaros/IKZF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...