Skip to main content

IDI1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-57587

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-57587

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for IDI1 Antibody

Immunogen

Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IDI1 Antibody

Western Blot: IDI1 Antibody [NBP1-57587] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for IDI1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IDI1

IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-492 BE891119.1 50-541 493-1758 BX648472.1 1201-2466 1759-2150 BX537663.1 4550-4941

Alternate Names

EC 5.3.3.2, IPP isomerase 1, IPP1, IPPI1, isopentenyl diphosphate dimethylallyl diphosphate isomerase 1, Isopentenyl pyrophosphate isomerase 1, isopentenyl-diphosphate delta isomerase, isopentenyl-diphosphate delta isomerase 1, isopentenyl-diphosphate Delta-isomerase 1

Gene Symbol

IDI1

UniProt

Additional IDI1 Products

Product Documents for IDI1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IDI1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...