Skip to main content

IARS2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-84638

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84638
NBP1-84638-25ul

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for IARS2 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VASQHNLPMDCLVDEDGVFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQWFINITDIKTA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IARS2 Antibody

Western Blot: IARS2 Antibody [NBP1-84638] - Analysis using Anti-IARS2 antibody NBP1-84638 (A) shows similar pattern to independent antibody NBP1-84639 (B).
Immunocytochemistry/Immunofluorescence: IARS2 Antibody [NBP1-84638] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
IARS2 Antibody

Immunohistochemistry-Paraffin- IARS2 Antibody [NBP1-84638] -

Immunohistochemistry-Paraffin- IARS2 Antibody [NBP1-84638] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Applications for IARS2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IARS2

The IARS2 gene encodes a 1,012 amino acid long, 113 kDA isoleucine-tRNA ligase, mitochondrial that participates in gene expression, mitochondrial tRNA aminoacylation and biosynthesis, as well as valine, leucine, and isoleucine biosynthesis. IARS2 has been linked to diabetes mellitus, cardiomyopathy, and pneumonia.

Alternate Names

EC 6.1.1, EC 6.1.1.5, FLJ10326, IleRS, isoleucine tRNA ligase 2, mitochondrial, Isoleucine--tRNA ligase, isoleucine-tRNA synthetase 2, mitochondrial, isoleucyl-tRNA synthetase 2, mitochondrial, isoleucyl-tRNA synthetase, mitochondrial, mitochondrial isoleucine tRNA synthetase

Gene Symbol

IARS2

Additional IARS2 Products

Product Documents for IARS2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IARS2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...