HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92180
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat, Bovine
Cited:
Human, Mouse, Rat, Bovine
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated
Cited:
Western Blot, IF/IHC, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 25622782). Use in Mouse reported in scientific literature (PMID:32377164). Use in Bovine reported in scientific literature (PMID: 32397071).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free
Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180]
Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.Western Blot: HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free [NBP1-92180] -
Niacin can activate the GPR109A/NRF2/autophagy signal pathway. The cells were collected at 0, 3, 6, 12, and 24 h to extract the total protein. The total protein was prepared and subjected to Western blotting using GPR109A, NRF-2, HO-1, and beta-tubulin antibodies. T-NRF-2 means total NRF-2. (a–d) The protein levels of GPR109A, NRF-2, and HO-1. The cells from different experimental groups were treated with niacin or shRNA+niacin for 24 h, and then, the total protein was collected. N-NRF-2 means NRF-2 in the nucleus. C-NRF-2 means NRF-2 in the cytoplasm. (e–h) The protein levels of GPR109A, C-NRF-2, N-NRF-2, and HO-1. Each immunoreactive band was digitized and expressed as a ratio of the beta-tubulin level. (i) The immunofluorescence results of the assay for NRF-2. The scale length in the figure is 200 μM. (j) The relative fluorescence intensity of NRF-2/ARE. The mRNA levels were determined by qRT-PCR. (k) The mRNA levels of ATG12, ATG4D, p62, ATG5, ULK1, ATG4B, Beclin, LC3B, and ATG7 were normalized to the level of beta-actin. The values are presented as the means +/- SD (∗ p < 0.05 and ∗∗ p < 0.01). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32397071), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free [NBP1-92180] -
(A) Effects of high glucose concentration (25.2 mM) on the mRNA expression of GPR109a in Caco-2 cells vs. low glucose concentration (5.6 mM). Results are expressed as means +/- standard error of the mean (SEM), n = 3, control = 5.6 mM glucose, control vs. 25.2 mM glucose, * p < 0.05; (B) Effects of high glucose (25.2 mM) on GPR109a protein expression in Caco-2 cells vs. control 5.6 mM glucose concentrations. Results are expressed as means +/- SEM, n = 6, control = 5.6 mM vs. 25.2 mM, * p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/26371038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Knockdown Validated
Reported in scientific publication (PMID: 32397071).
Western Blot
Reported in scientific literature (PMID 25622782).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HM74A/PUMA-G/GPR109A
Long Name
G Protein-coupled Receptor HM74A/G Protein-coupled Receptor 109A
Alternate Names
GPR109A, HCA2, HCAR2, Niacr1, Nicotinic Acid Receptor, PUMAG
Entrez Gene IDs
338442 (Human)
Gene Symbol
HCAR2
UniProt
Additional HM74A/PUMA-G/GPR109A Products
Product Documents for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free
Product Specific Notices for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...