Skip to main content

HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92180

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-92180
NBP1-92180-25ul

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat, Bovine

Cited:

Human, Mouse, Rat, Bovine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Cited:

Western Blot, IF/IHC, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25622782). Use in Mouse reported in scientific literature (PMID:32377164). Use in Bovine reported in scientific literature (PMID: 32397071).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180]

Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180]

Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Western Blot: HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free [NBP1-92180] -

Niacin can activate the GPR109A/NRF2/autophagy signal pathway. The cells were collected at 0, 3, 6, 12, and 24 h to extract the total protein. The total protein was prepared and subjected to Western blotting using GPR109A, NRF-2, HO-1, and beta-tubulin antibodies. T-NRF-2 means total NRF-2. (a–d) The protein levels of GPR109A, NRF-2, and HO-1. The cells from different experimental groups were treated with niacin or shRNA+niacin for 24 h, and then, the total protein was collected. N-NRF-2 means NRF-2 in the nucleus. C-NRF-2 means NRF-2 in the cytoplasm. (e–h) The protein levels of GPR109A, C-NRF-2, N-NRF-2, and HO-1. Each immunoreactive band was digitized and expressed as a ratio of the beta-tubulin level. (i) The immunofluorescence results of the assay for NRF-2. The scale length in the figure is 200 μM. (j) The relative fluorescence intensity of NRF-2/ARE. The mRNA levels were determined by qRT-PCR. (k) The mRNA levels of ATG12, ATG4D, p62, ATG5, ULK1, ATG4B, Beclin, LC3B, and ATG7 were normalized to the level of beta-actin. The values are presented as the means +/- SD (∗ p < 0.05 and ∗∗ p < 0.01). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32397071), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Western Blot: HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free [NBP1-92180] -

(A) Effects of high glucose concentration (25.2 mM) on the mRNA expression of GPR109a in Caco-2 cells vs. low glucose concentration (5.6 mM). Results are expressed as means +/- standard error of the mean (SEM), n = 3, control = 5.6 mM glucose, control vs. 25.2 mM glucose, * p < 0.05; (B) Effects of high glucose (25.2 mM) on GPR109a protein expression in Caco-2 cells vs. control 5.6 mM glucose concentrations. Results are expressed as means +/- SEM, n = 6, control = 5.6 mM vs. 25.2 mM, * p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/26371038), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Knockdown Validated

Reported in scientific publication (PMID: 32397071).

Western Blot

Reported in scientific literature (PMID 25622782).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HM74A/PUMA-G/GPR109A

Nicotinic acid receptors are a group of Gi/Go protein-coupled receptors that are currently divided into GPR81, GPR109Aand GPR109B subtypes. GPR109B receptors originated from a gene duplication of GPR109A and have > 95% homology. Allsubtypes are widely expressed throughout adipose tissue and are found at lower levels on macrophages, neutrophils,Langerhans cells and in the spleen. Nicotinic acid receptors are involved in the inhibition of lipolysis. The humangenes encoding these receptors are located on chromosome 12 (12q24.3)

Long Name

G Protein-coupled Receptor HM74A/G Protein-coupled Receptor 109A

Alternate Names

GPR109A, HCA2, HCAR2, Niacr1, Nicotinic Acid Receptor, PUMAG

Entrez Gene IDs

338442 (Human)

Gene Symbol

HCAR2

UniProt

Additional HM74A/PUMA-G/GPR109A Products

Product Documents for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...