Skip to main content

HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Catalog # NBP1-92180 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-92180
NBP1-92180-25ul

Key Product Details

Species Reactivity

Human, Mouse, Rat, Bovine

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25622782). Use in Mouse reported in scientific literature (PMID:32377164). Use in Bovine reported in scientific literature (PMID: 32397071).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Applications for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Knockdown Validated

-Reported in scientific publication (PMID: 32397071).

Western Blot

-Reported in scientific literature (PMID 25622782).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 6 publications using NBP1-92180 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HM74A/PUMA-G/GPR109A

Nicotinic acid receptors are a group of Gi/Go protein-coupled receptors that are currently divided into GPR81, GPR109Aand GPR109B subtypes. GPR109B receptors originated from a gene duplication of GPR109A and have > 95% homology. Allsubtypes are widely expressed throughout adipose tissue and are found at lower levels on macrophages, neutrophils,Langerhans cells and in the spleen. Nicotinic acid receptors are involved in the inhibition of lipolysis. The humangenes encoding these receptors are located on chromosome 12 (12q24.3)

Long Name

G Protein-coupled Receptor HM74A/G Protein-coupled Receptor 109A

Alternate Names

GPR109A, HCA2, HCAR2, Niacr1, Nicotinic Acid Receptor, PUMAG

Entrez Gene IDs

338442 (Human)

Gene Symbol

HCAR2

UniProt

Product Documents for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...