GNB1L Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84993

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84993-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all GNB1L Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human GNB1L. Peptide sequence: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GNB1L Antibody - BSA Free

Western Blot: GNB1L Antibody [NBP2-84993]

Western Blot: GNB1L Antibody [NBP2-84993]

Western Blot: GNB1L Antibody [NBP2-84993] - Host: Rabbit. Target Name: GNB1L. Sample Tissue: Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for GNB1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNB1L

The GNB1L gene codes a guanine nucleotide-binding protein subunit beta-like protein 1 that is a member of the WD repeat protein family. Isoform 1 is 327 amino acids long with a mass of around 35 kDA while isoform 2 exists at 212 amino acids long and nearly 23 kDA. Members of the WD repeat protein family are known for their involvement in many cellular responses such as: cycle progression, signal transduction, apoptosis, and gene regulation. The GNB1L gene can be found on chromosome 22q11, and if deleted, will cause DiGeorge syndrome. The GNB1L gene has been researched regarding its role in schizophrenia, spinal cord disease, carcinoma, cat eye syndrome, hypopharynx cancer, and visceral leishmaniasis. GNB1L gene interacts with genes KLHL12 and UBC in pathways such as the beta-agonist/beta blocker.

Alternate Names

DGCRK3, G-protein beta subunit-like protein, guanine nucleotide binding protein (G protein), beta polypeptide 1-like, guanine nucleotide binding protein beta-subunit-like polypeptide, guanine nucleotide-binding protein subunit beta-like protein 1, GY2WD40 repeat-containing protein deleted in VCFS, KIAA1645, WD repeat-containing protein 14, WDR14G protein subunit beta-like protein 1, WDVCF

Gene Symbol

GNB1L

Additional GNB1L Products

Product Documents for GNB1L Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GNB1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.