GFI1B Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84040

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84040-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all GFI1B Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1B. Peptide sequence: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GFI1B Antibody - BSA Free

Western Blot: GFI1B Antibody [NBP2-84040]

Western Blot: GFI1B Antibody [NBP2-84040]

Western Blot: GFI1B Antibody [NBP2-84040] - WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040]

Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040]

Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040] - Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule and renal corpuscle. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Western Blot: GFI1B Antibody [NBP2-84040]

Western Blot: GFI1B Antibody [NBP2-84040]

Western Blot: GFI1B Antibody [NBP2-84040] - Host: Rabbit. Target: GFI1B. Positive control (+): Mouse testis (M-TE). Negative control (-): Rat liver (R-LI). Antibody concentration: 1ug/ml
View 1 more images

Applications for GFI1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFI1B

The GFI1B gene codes for a zinc finger protein Gfi-1b. Isoform 1 (p37) is 330 amino acids in length at around 37 kDA while isoform 2 (p32) is 284 amino acids long at approximately 32 kDA. GFI1B is essential in transcriptional regulation which is critical for the development and differentiation of erythroid and magakaryocytic lineages. Research is investigating the role of GFI1B in aplastic anemia, ataxia, chronic leukemia, anemia, neutropenia, and hematopoiesis. This gene has interacted with JAG2, BRE, LTBP4, EFEMP1, and EFEMP2 to contribute to pathways of lymphocyte signaling.

Alternate Names

growth factor independent 1B transcription repressor, Growth factor independent protein 1B, Potential regulator of CDKN1A translocated in CML, translocated inCML), zinc finger protein Gfi-1b

Gene Symbol

GFI1B

Additional GFI1B Products

Product Documents for GFI1B Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GFI1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.