Skip to main content

Fucosyltransferase 8/FUT8 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79869

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-79869

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen for this antibody is FUT8. Peptide sequence LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Fucosyltransferase 8/FUT8 Antibody - BSA Free

Western Blot: Fucosyltransferase 8/FUT8 Antibody [NBP1-79869]

Western Blot: Fucosyltransferase 8/FUT8 Antibody [NBP1-79869]

Western Blot: Fucosyltransferase 8/FUT8 Antibody [NBP1-79869] - Fetal Liver Lysate 1ug/ml Gel Concentration 12%
Fucosyltransferase 8/FUT8 Antibody - BSA Free

Western Blot: Fucosyltransferase 8/FUT8 Antibody - BSA Free [NBP1-79869] -

The relationship between the expression of FUT8 and E. coli infection was analyzed at the tissue and cell levels. (A) Expression of the FUT8 gene in 12 tissues of 35-day-old Meishan pigs. (B) Differential expression analysis of the FUT8 gene in intestinal tissues between E. coli F18-resistant and -sensitive Meishan piglets. (C) Expression levels of FUT8 in IPEC-J2 cells with E. coli infection were determined by Western blotting. (D) FUT8 expression analysis in IPEC-J2 cells was determined using Western blotting, which was induced by 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h. (E) Expression of FUT8 in IPEC-J2 cells with E. coli infection was determined by RT-qPCR testing. (F) FUT8 expression in IPEC-J2 cells with 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h induction was determined using RT-qPCR testing. * Represents a significant difference (p < 0.05) and ** represents an extremely significant difference (p < 0.01). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499043), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Fucosyltransferase 8/FUT8 Antibody - BSA Free

Western Blot: Fucosyltransferase 8/FUT8 Antibody - BSA Free [NBP1-79869] -

The relationship between the expression of FUT8 and E. coli infection was analyzed at the tissue and cell levels. (A) Expression of the FUT8 gene in 12 tissues of 35-day-old Meishan pigs. (B) Differential expression analysis of the FUT8 gene in intestinal tissues between E. coli F18-resistant and -sensitive Meishan piglets. (C) Expression levels of FUT8 in IPEC-J2 cells with E. coli infection were determined by Western blotting. (D) FUT8 expression analysis in IPEC-J2 cells was determined using Western blotting, which was induced by 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h. (E) Expression of FUT8 in IPEC-J2 cells with E. coli infection was determined by RT-qPCR testing. (F) FUT8 expression in IPEC-J2 cells with 1 ug/mL LPS at 0 h, 2 h, 4 h, and 6 h induction was determined using RT-qPCR testing. * Represents a significant difference (p < 0.05) and ** represents an extremely significant difference (p < 0.01). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499043), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Fucosyltransferase 8/FUT8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fucosyltransferase 8/FUT8

FUT8 belongs to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq]

Alternate Names

alpha 1,6 Fucosyltransferase, alpha1-6FucT, FUT8

Gene Symbol

FUT8

Additional Fucosyltransferase 8/FUT8 Products

Product Documents for Fucosyltransferase 8/FUT8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Fucosyltransferase 8/FUT8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...