Skip to main content

FAM80A Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87935

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87935
NBP1-87935-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit FAM80A Antibody - BSA Free (NBP1-87935) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for FAM80A Antibody - BSA Free

FAM80A Antibody - BSA Free Immunohistochemistry-Paraffin: FAM80A Antibody - BSA Free [NBP1-87935]

Immunohistochemistry-Paraffin: FAM80A Antibody - BSA Free [NBP1-87935]

Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

Applications for FAM80A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM80A

Alternate Names

EC 6.3.2.n6, FAM80A, family with sequence similarity 80, member A, MGC47816, NAAG synthetase A, NAAGS, ribosomal modification protein rimK-like family member A, Ribosomal protein S6 modification-like protein A, RP11-157D18.1

Gene Symbol

RIMKLA

Additional FAM80A Products

Product Documents for FAM80A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FAM80A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...