Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

Desert Hedgehog/Dhh Antibody (2D5), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00050846-M02

Catalog #
Availability
Size / Price
Qty
Loading...
H00050846-M02

Key Product Details

Species Reactivity

Human

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2D5

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Desert Hedgehog/Dhh Antibody (2D5)

Immunogen

DHH (NP_066382, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP*

Specificity

DHH - desert hedgehog homolog (Drosophila) (2D5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Desert Hedgehog/Dhh Antibody (2D5)

Western Blot: Desert Hedgehog/Dhh Antibody (2D5) [H00050846-M02] - DHH monoclonal antibody (M02), clone 2D5. Analysis of DHH expression in human liver.

Applications for Desert Hedgehog/Dhh Antibody (2D5)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This product is useful for ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Desert Hedgehog/Dhh

This gene encodes a member of the Hedgehog family. The hedgehog gene family encodes signaling molecules that play an important role in regulating morphogenesis. This protein is predicted to be made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the organism. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. This protein may be involved in both male gonadal differentiation and perineurial development. [provided by RefSeq]

Alternate Names

DHH

Entrez Gene IDs

50846 (Human)

Gene Symbol

DHH

Additional Desert Hedgehog/Dhh Products

Product Documents for Desert Hedgehog/Dhh Antibody (2D5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Desert Hedgehog/Dhh Antibody (2D5)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...