Skip to main content

Cyclophilin 40 Antibody (4O7P5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16552

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16552-100ul
NBP3-16552-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4O7P5 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 271-370 of human Cyclophilin 40 (Q08752). IALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Cyclophilin 40 Antibody (4O7P5) (NBP3-16552) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Cyclophilin 40 Antibody (4O7P5)

Western Blot: Cyclophilin 40 Antibody (4O7P5) [NBP3-16552]

Western Blot: Cyclophilin 40 Antibody (4O7P5) [NBP3-16552]

Western Blot: Cyclophilin 40 Antibody (4O7P5) [NBP3-16552] - Western blot analysis of extracts of various cell lines, using Cyclophilin 40 Rabbit mAb (NBP3-16552) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody (4O7P5) [NBP3-16552]

Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody (4O7P5) [NBP3-16552]

Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody (4O7P5) [NBP3-16552] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Cyclophilin 40 Rabbit mAb (NBP3-16552) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Cyclophilin 40 Antibody (4O7P5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cyclophilin 40

Immunophilins are a family of soluble cytosolic receptors capable of binding to one of two major immunosuppressant agents: cyclosporin A (CsA) or FK506. Proteins that bind FK506 are termed FK506 Binding Proteins (FKBPs) and those that bind cyclosporin A are called cyclophilins (CyP). Both CyP:CsA and FKBP:FK506 complexes have been shown to inhibit calcineurin, a calcium and calmodulin dependent protein phosphatase which has been implicated as an important signaling enzyme in T-cell activation, providing a possible mechanism of immunosuppression by CsA and FK506. Immunophilins function as peptidyl prolyl cis-trans-isomerases (PPIase) whose activity is inhibited by their respective immunosuppressant compounds. As PPIase's, immunophilins accelerate folding of some proteins both in vivo and in vitro by catalyzing slow steps in the initial folding and rearrangement of proline containing proteins. CyP 40, a 40 kDa protein, shares significant homology with smaller CyPA (CyP 18) and FKBP59. CyP 40 exhibits the characteristic CsA binding and isomerase activity of CyP 18, though these activities appear to be less with CyP 40 than with Cyp 18. Like FKBP59, CyP 40 has been found in progesterone receptor complexes. CyP 40 is expressed at similar levels in many tissues.

Alternate Names

40 kDa peptidyl-prolyl cis-trans isomerase, 40 kDa peptidyl-prolyl cis-trans isomerase D, cyclophilin D, Cyclophilin-40, Cyclophilin-related protein, CYP40, CYP-40cyclophilin 40, CYPD, EC 5.2.1.8, MGC33096, peptidyl-prolyl cis-trans isomerase D, peptidylprolyl isomerase D, peptidylprolyl isomerase D (cyclophilin D), PPIase D, Rotamase D

Gene Symbol

PPID

Additional Cyclophilin 40 Products

Product Documents for Cyclophilin 40 Antibody (4O7P5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cyclophilin 40 Antibody (4O7P5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...