CKS1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88788

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP2-88788 has been discontinued. View all CKS1 products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all CKS1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CKS1. Peptide sequence: MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CKS1 Antibody - BSA Free

Western Blot: CKS1 Antibody [NBP2-88788]

Western Blot: CKS1 Antibody [NBP2-88788]

Western Blot: CKS1 Antibody [NBP2-88788] - Host: Rabbit. Target Name: CKS1. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for CKS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CKS1

CKS1B (Cyclin-dependent kinases regulatory subunit 1) is a 79 amino acid protein that binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. Depleting CKS1B in breast cancer cells has been shown to slow cell cycle progression and regulation of CKS1B may provide a potential cancer treatment option. Besides breast cancer, CKS1B plays a role in multiple myeloma, adenocarcinoma, mantle cell lymphoma , oral squamous cell carcinoma, squamous cell carcinoma, cholesteatoma, paracoccidioidomycosis, intrahepatic cholangiocarcinoma, hepatoblastoma, hepatocellular carcinoma, non-small cell lung carcinoma, gallbladder carcinoma, basal cell carcinoma, endometrial carcinoma, renal cell carcinoma and thyroid carcinoma.

Alternate Names

CDC28 protein kinase 1, CDC28 protein kinase 1B, CDC28 protein kinase regulatory subunit 1B, cell division control protein CKS1, CKS-1, CKS1CDC2-associated protein CKS1, ckshs1, cyclin-dependent kinases regulatory subunit 1, NB4 apoptosis/differentiation related protein, PNAS-143, PNAS-16, PNAS-18

Gene Symbol

CKS1B

Additional CKS1 Products

Product Documents for CKS1 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CKS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.