Skip to main content

Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16077

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16077-100ul
NBP3-16077-20ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7T1R3 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Chitinase 3-like 1 (NP_001267.2). PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Chitinase 3-like 1/YKL-40 Antibody (7T1R3) (NBP3-16077) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of THP-1 cells, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of various cell lines, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] -

Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] - Confocal imaging of THP-1 cells using Chitinase 3-like 1/YKL-40 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Chitinase 3-like 1/YKL-40

Chitinase 3-like 1/YKL-40 (CHI3L1), also called BRP39 in mouse, is a 39 kDa glycoprotein member of the glycosyl hydrolase 18 family although it does not show chitotriosidase activity. CHI3L1 is expressed by articular chondrocytes, synovial cells, activated monocyte-derived macrophages, neutrophils, endothelial cells, vascular smooth muscle cells, and some cancer cells. CHI3L1 binds to chitin and heparins, and it enhances cell adhesion, proliferation and tumor angiogenesis. Circulating CHI3L1 is elevated during inflammation and connective tissue remodeling such as arthritis, chronic obstructive pulmonary disease, diabetes, cardiovascular disease, inflammatory bowel disease, and liver cirrhosis. It is frequently upregulated in glioblastoma, myxoid chondrosarcoma, melanoma and carcinomas of the breast, thyroid, colon, lung, kidney, and ovary.

Alternate Names

CHI3L1, Chitinase 3 like 1, HCgp39, YKL-40

Gene Symbol

CHI3L1

Additional Chitinase 3-like 1/YKL-40 Products

Product Documents for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...