CABLES1 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # H00091768-B01P
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Mouse IgG
Format
Azide and BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
CABLES1 (NP_612384.1, 1 a.a. - 368 a.a.) full-length human protein. MLSKRGCHARIYADFPIRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS
Specificity
CABLES1 - Cdk5 and Abl enzyme substrate 1,
Clonality
Polyclonal
Host
Mouse
Isotype
IgG
Description
Novus Biologicals Mouse CABLES1 Antibody - Azide and BSA Free (H00091768-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for CABLES1 Antibody - Azide and BSA Free
Western Blot: CABLES1 Antibody [H00091768-B01P]
Western Blot: CABLES1 Antibody [H00091768-B01P] - Analysis of CABLES1 expression in transfected 293T cell line by CABLES1 polyclonal antibody. Lane 1: CABLES1 transfected lysate(40.48 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: CABLES1 Antibody [H00091768-B01P]
Immunocytochemistry/Immunofluorescence: CABLES1 Antibody [H00091768-B01P] - Analysis of purified antibody to CABLES1 on HeLa cell. (antibody concentration 10 ug/ml)Applications for CABLES1 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: CABLES1
Alternate Names
CABL1, CABLES, Cdk5 and Abl enzyme substrate 1, CDK5 and ABL1 enzyme substrate 1, FLJ35924, HsT2563, IK3-1, Interactor with CDK3 1
Entrez Gene IDs
91768 (Human)
Gene Symbol
CABLES1
UniProt
Additional CABLES1 Products
Product Documents for CABLES1 Antibody - Azide and BSA Free
Product Specific Notices for CABLES1 Antibody - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...