BTG3 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89098
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BTG3 Antibody - BSA Free
Western Blot: BTG3 Antibody [NBP1-89098]
Western Blot: BTG3 Antibody [NBP1-89098] - Analysis in control (vector only transfected HEK293T lysate) and BTG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunohistochemistry-Paraffin: BTG3 Antibody [NBP1-89098]
Immunohistochemistry-Paraffin: BTG3 Antibody [NBP1-89098] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells along with extracellular material.Western Blot: BTG3 Antibody - BSA Free [NBP1-89098] -
NOXA was identified as the candidate gene underlying the synergistic antitumor effects of cisplatin and narciclasine. A Schematic overview of the workflow for selection and validation of candidate genes. B Heatmap showing the fold changes in the expression of potential candidate genes under different treatment conditions. C NOXA-, MAFF-, and BTG3-silenced A549 tumor spheroids were treated with individual or combination treatments of cisplatin and narciclasine for 48 h, and cell viability was assessed by measuring cellular ATP content. *p < 0.05 versus combination-treated small interfering RNA for the negative control (siNC). Data are mean +/- SEM from three independent experiments in triplicate. Images were taken prior to viability assay. Scale bar: 100 μm. D Under the siRNA transfection and treatment conditions described in (C), cleaved caspase-7 (cCASP7) levels were analyzed to assess apoptosis. Data represent one of three independent experiments with similar results. E Twenty-four hours after treatment of tumor spheroids with individual or combination treatment of cisplatin and narciclasine, the mRNA levels of NOXA, MAFF, and BTG3 were assessed using RT-qPCR. Data are presented as fold change in gene expression, normalized to GAPDH expression. *p < 0.05 versus vehicle. Data are mean +/- SEM from three independent experiments in triplicate. F Following 48 h of treatment under the indicated treatment conditions, protein levels of NOXA, MAFF, and BTG3 were assessed using western blotting. beta-Actin and GAPDH were used as the loading control. Experiments were conducted in triplicate. Data represent one of three independent experiments with similar results Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40369444), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for BTG3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BTG3
Alternate Names
Abundant in neuroepithelium area protein, ANATOB55, B-cell translocation gene 3, B-cell translocation gene10, BTG family member 3, BTG family, member 3, MGC8928, protein BTG3, Protein Tob5, tob55, TOB5TOFA
Gene Symbol
BTG3
Additional BTG3 Products
Product Documents for BTG3 Antibody - BSA Free
Product Specific Notices for BTG3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...