Skip to main content

ATP6V0D1 Antibody (2G12) - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # H00009114-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00009114-M01

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2G12

Format

Azide and BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN

Reactivity Notes

Human. Other species not tested.

Specificity

ATP6V0D1 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for ATP6V0D1 Antibody (2G12) - Azide and BSA Free

Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01]

Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01]

Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01] - ATP6V0D1 monoclonal antibody (M01), clone 2G12 Analysis of ATP6V0D1 expression in HeLa.
Immunohistochemistry-Paraffin: ATP6V0D1 Antibody (2G12) [H00009114-M01]

Immunohistochemistry-Paraffin: ATP6V0D1 Antibody (2G12) [H00009114-M01]

Immunohistochemistry-Paraffin: ATP6V0D1 Antibody (2G12) [H00009114-M01] - Analysis of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 0.5 ug/ml.
Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01]

Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01]

Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01] - Analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody (M01), clone 2G12.Lane 1: ATP6V0D1 transfected lysate(40.3 KDa).Lane 2: Non-transfected lysate.

Applications for ATP6V0D1 Antibody (2G12) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ATP6V0D1

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.

Alternate Names

32 kDa accessory protein, ATP6D, ATP6DV, ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1, FLJ43534, H(+)-transporting two-sector ATPase, subunit D, p39, Vacuolar proton pump subunit d 1, V-ATPase 40 kDa accessory protein, V-ATPase AC39 subunit, V-ATPase, subunit D, VATX, Vma6, VPATPDV-ATPase subunit d 1, V-type proton ATPase subunit d 1

Entrez Gene IDs

9114 (Human)

Gene Symbol

ATP6V0D1

OMIM

607028 (Human)

Additional ATP6V0D1 Products

Product Documents for ATP6V0D1 Antibody (2G12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP6V0D1 Antibody (2G12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...