Skip to main content

Ataxin 1 Antibody (S76-8) - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-42186

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2B Clone # S76-8

Format

BSA Free

Concentration

1 mg/ml

Product Specifications

Immunogen

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Reactivity Notes

Immunogen displays sequence identity for non-tested species: Human and Rat.

Localization

Cytoplasm , Nucleus

Specificity

Detects approx 85kDa.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2B

Description

Novus Biologicals Mouse Ataxin 1 Antibody (S76-8) - BSA Free (NBP2-42186) is a monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Ataxin 1 Antibody (S76-8) - BSA Free

Western Blot: Ataxin 1 Antibody (S76-8) [NBP2-42186]

Western Blot: Ataxin 1 Antibody (S76-8) [NBP2-42186]

Western Blot: Ataxin 1 Antibody (S76-8) [NBP2-42186] - Western Blot analysis of Monkey COS-1 cells transfected with Ataxin- 1 showing detection of ~85 kDa Ataxin 1 protein using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (NBP2-42186). Lane 1: Molecular Weight Ladder. Lane 2: Monkey COS-1 cells transfected with Ataxin- 1. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (NBP2-42186) at 1:200 for 16 hours at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~85 kDa.
Immunocytochemistry/ Immunofluorescence: Ataxin 1 Antibody (S76-8) [NBP2-42186]

Immunocytochemistry/ Immunofluorescence: Ataxin 1 Antibody (S76-8) [NBP2-42186]

Immunocytochemistry/Immunofluorescence: Ataxin 1 Antibody (S76-8) [NBP2-42186] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (NBP2-42186). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (NBP2-42186) at 1:100 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Ataxin 1 Antibody (D) Composite.
Immunocytochemistry/ Immunofluorescence: Ataxin 1 Antibody (S76-8) [NBP2-42186]

Immunocytochemistry/ Immunofluorescence: Ataxin 1 Antibody (S76-8) [NBP2-42186]

Immunocytochemistry/Immunofluorescence: Ataxin 1 Antibody (S76-8) [NBP2-42186] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (NBP2-42186). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (NBP2-42186) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) Ataxin 1 Antibody. (D) Composite.

Applications for Ataxin 1 Antibody (S76-8) - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100

Western Blot

1:1000
Application Notes
1 ug/ml of Ataxin 1 Antibody was sufficient for detection of Ataxin-1 in 20 ug of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary Antibody.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS (pH 7.4), 50% Glycerol

Format

BSA Free

Preservative

0.1% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ataxin 1

Defects in Ataxin-1 are the cause of spinocerebellar ataxia type 1 (SCA1), also known as olivopontocerebellar atrophy I (OPCA I or OPCA1). Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA1 is caused by expansion of a CAG repeat in the coding region of the ataxin-1 gene. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. Ataxin-1 binds RNA in vitro and may be involved in RNA metabolism. [Uniprot]

Alternate Names

ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein

Gene Symbol

ATXN1

UniProt

Additional Ataxin 1 Products

Product Documents for Ataxin 1 Antibody (S76-8) - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ataxin 1 Antibody (S76-8) - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...