Skip to main content

ASC2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86581

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86581-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASC2. Peptide sequence: REAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ASC2 Antibody - BSA Free

Western Blot: ASC2 Antibody [NBP2-86581]

Western Blot: ASC2 Antibody [NBP2-86581]

Western Blot: ASC2 Antibody [NBP2-86581] - Host: Rabbit. Target Name: PYDC1. Sample Type: Lymph Node Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for ASC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASC2

ASC2/POP1 is a PAAD domain only protein originally identified in a bioinformatics screen aimed at understanding molecular apoptosis mechanisms (Pawtokski et al, 2001; reviewed in Fabiola et al, 2006, and Mariathasan and Vuvic, 2003.). ASC2/POP1 has high amino acid sequence homology with ASC (64%), hence it was originally termed ASC2. The PAAD (also known as PYRIN) domain is a conserved sequence motif identified in more than 35 human proteins with putative functions in apoptosis and inflammatory signaling pathways. PAAD was named after the protein families from which it was discovered: pyrin, AIM (absent-in-melanoma), ASC [apoptosis-associated speck-like protein containing a caspase recruitment domain (CARD], and death-domain (DD)-like. PAAD is thought to function as a protein-protein interaction domain, possibly coupling different signaling pathways such as apoptosis, inflammation and cancer. For example, PAADs are capable of homotypic interactions with themselves or other members of the PAAD family, suggesting that they participate in complex protein-interaction networks that link various signalling pathways. In humans, the gene encoding ASC2/POP1 is on chromosome 16p12.1, only 14 kbp away from the ASC locus. The close proximity of ASC2/POP1 to ASC as well as the high sequence homology between them suggest that the ASC2/POP1 and ASC genes arose by gene duplication. Studies have shown that ASC2/POP1 associates with ASC via PADD-PADD interactions and modulates ASC-mediated roles in apoptosis and inflammation. ASC2/POP1 may also have a role in modulating other multidomain PAAD-containing proteins. However, the physiological relevance of ASC2/POP1 remains to be fully elucidated. Human ASC2/POP1 is an 89 amino acid protein and migrates at ~10-12 kDa on SDS-PAGE gels (Stehlik et al, 2003).

Alternate Names

ASC2PAAD-only protein 1, ASCI, POP1pyrin domain-containing protein 1, PYC1, PYD (pyrin domain) containing 1, pyrin domain containing 1, pyrin-domain containing protein 1, Pyrin-only protein 1

Gene Symbol

PYDC1

Additional ASC2 Products

Product Documents for ASC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ASC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...