Skip to main content

ACOT7 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89278

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89278

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACOT7 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACOT7 Antibody

Western Blot: ACOT7 Antibody [NBP1-89278] - Analysis using Anti-ACOT7 antibody NBP1-89278 (A) shows similar pattern to independent antibody NBP1-89279 (B).
Immunocytochemistry/Immunofluorescence: ACOT7 Antibody [NBP1-89278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for ACOT7 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT7

The ACOT7 gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester ofpalmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesialtemporal lobe epilepsy. Alternatively

Alternate Names

ACH1, acyl-CoA thioesterase 7CTE-IIa, BACHEC 3.1.2.2, brain acyl CoA hydrolase, Brain acyl-CoA hydrolase, CTE-IILACH, cytosolic acyl coenzyme A thioester hydrolase, hBACH, long chain, Long chain acyl-CoA thioester hydrolase

Entrez Gene IDs

11332 (Human)

Gene Symbol

ACOT7

UniProt

Additional ACOT7 Products

Product Documents for ACOT7 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...