Skip to main content

ACCN4 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83921

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83921-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ACCN4. Peptide sequence: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ACCN4 Antibody - BSA Free (NBP2-83921) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ACCN4 Antibody - BSA Free

Western Blot: ACCN4 Antibody [NBP2-83921]

Western Blot: ACCN4 Antibody [NBP2-83921]

Western Blot: ACCN4 Antibody [NBP2-83921] - WB Suggested Anti-ACCN4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:500. Positive Control: Jurkat cell lysate

Applications for ACCN4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACCN4

ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder. FUNCTION: Probable cation channel with high affinity for sodium. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins (Probable). SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: This gene is predominantly expressed in the pituitary gland. Expressed in brain, spinal chord and dorsal root ganglion (DRG). Expressed by a subset of sensory neurons in the DRG. Expressed by granule cells in the cerebellar cortex. In hippocampus, expression is detected in dentate gyrus granule cells, in pyramidal cells of CA1-CA3 subfields and in interneurons of the striatum oriens and radiatum of all subfields. In cerebral cortex expressed in small, medium and large pyramidal cells in layers 2, 3 and 5 respectively. Also expressed in striatum, globus pallidus, inferior and superior calliculi, amygdala, magnocellular preoptic nucleus, islands of Calleja and large neurons of olfactory tubercules. DEVELOPMENTAL STAGE: Highly expressed in newborn spinal chord but hardly detected in the cerebellum compared to adult. Expressed at postnatal day 1 in ependymal cells lining the central canal of spinal chord and in motor neurons. In adult, expression decreases in ependymal cells and increases in motor neurons. The number of positive interneurons decreases but the individual interneuron expression increases in adult spinal chord compared to newborn. MISCELLANEOUS: In vitro, has no proton-gated channel activity.

Alternate Names

Acid-sensing ion channel 4, amiloride-sensitive cation channel 4, pituitaryMGC17248, ASIC4MGC24860, BNAC4amiloride-sensitive cation channel 4, brain sodium channel 4

Gene Symbol

ASIC4

Additional ACCN4 Products

Product Documents for ACCN4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACCN4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...