Skip to main content

ACAD8 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-48529

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48529-25ul
NBP2-48529

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAD8 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACAD8 Antibody

Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-48529] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Applications for ACAD8 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAD8

Isobutyryl-CoA dehydrogenase (EC 1.3.99), encoded by the ACAD8 gene, catalyzes the third step of the degradation of the branched chain amino acid valine (Nguyen et al., 2002 [PubMed 12359132]).[supplied by OMIM]

Alternate Names

ACAD-8, Activator-recruited cofactor 42 kDa component, Acyl-CoA dehydrogenase family member 8, acyl-CoA dehydrogenase family, member 8, acyl-Coenzyme A dehydrogenase family, member 8, ARC42, EC 1.3.99, EC 1.3.99.-, FLJ22590, IBD, isobutyryl-CoA dehydrogenase, mitochondrial

Gene Symbol

ACAD8

Additional ACAD8 Products

Product Documents for ACAD8 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAD8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...