Skip to main content

ABI2 Antibody - Azide and BSA Free, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-92201

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-92201-0.1ml
NBP2-92201-0.02ml

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for ABI2 Antibody - Azide and BSA Free

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1). HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABI2 Antibody - Azide and BSA Free

Western Blot: ABI2 Antibody [NBP2-92201] - Analysis of extracts of various cell lines, using ABI2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

Applications for ABI2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ABI2

ABI2 may act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May be involved in cytoskeletal reorganization.Regulates ABL1/c-Abl-mediated phosphorylation of MENA

Alternate Names

Abelson interactor 2, Abi-2, ABI2B, abl binding protein 3, abl interactor 2, Abl-binding protein 3, AblBP3ABI-2, abl-interacting protein 1 (SH3-containing protein), abl-interactor 2, abl-interactor protein 2b, AIP-1, arg protein tyrosine kinase-binding protein, Arg-binding protein 1, ArgBP1, ARGBPIA, argBPIB, SSH3BP2

Gene Symbol

ABI2

Additional ABI2 Products

Product Documents for ABI2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABI2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...