Skip to main content

ABHD12B Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-82546

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-82546-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for ABHD12B Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of ABHD12B. Peptide sequence: ARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVAS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ABHD12B Antibody

Western Blot: ABHD12B Antibody [NBP2-82546] - WB Suggested Anti-ABHD12B Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for ABHD12B Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABHD12B

Alternate Names

abhydrolase domain containing 12B, abhydrolase domain-containing protein 12B, BEM46L3, c14_5314, C14orf29, chromosome 14 open reading frame 29, EC 3.-, MGC129926, MGC129927

Gene Symbol

ABHD12B

Additional ABHD12B Products

Product Documents for ABHD12B Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABHD12B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...