Skip to main content

ABHD1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-79333

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-79333

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ABHD1 Antibody

Immunogen

Synthetic peptide directed towards the middle region of human ABHD1The immunogen for this antibody is ABHD1. Peptide sequence GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ABHD1 Antibody

Western Blot: ABHD1 Antibody [NBP1-79333] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for ABHD1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABHD1

ABHD1 is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions. [provided by RefSeq]

Alternate Names

abhydrolase domain containing 1, EC 3.1.1, EC 3.1.1.-, FLJ36128, LABH1abhydrolase domain-containing protein 1, Lung alpha/beta hydrolase 1

Gene Symbol

ABHD1

Additional ABHD1 Products

Product Documents for ABHD1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABHD1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...