Skip to main content

AADACL1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-86930

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86930

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for AADACL1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AADACL1. Peptide sequence: GIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for AADACL1 Antibody

Western Blot: AADACL1 Antibody [NBP2-86930] - Host: Rabbit. Target Name: NCEH1. Sample Type: THP-1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for AADACL1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AADACL1

Hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. May be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. Also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. May contribute to cancer pathogenesis by promoting tumor cell migration.

Long Name

Neutral cholesterol ester hydrolase 1

Alternate Names

EC 3.1.1.-, EC 3.1.1.71, KIAA1363, NCEH, NCEH1

Gene Symbol

NCEH1

Additional AADACL1 Products

Product Documents for AADACL1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AADACL1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...