Skip to main content

A2LD1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-82542

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-82542-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for A2LD1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human A2LD1. Peptide sequence: GTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for A2LD1 Antibody

Western Blot: A2LD1 Antibody [NBP2-82542] - Host: Rabbit. Target Name: A2LD1. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for A2LD1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: A2LD1

Alternate Names

AIG2-like domain 1, AIG2-like domain-containing protein 1, gamma-glutamylamine cyclotransferase, gamma-glutamylaminecyclotransferase, GGACT

Gene Symbol

GGACT

Additional A2LD1 Products

Product Documents for A2LD1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for A2LD1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...