Skip to main content

A2LD1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-38064

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38064-25ul
NBP2-38064

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for A2LD1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for A2LD1 Antibody

Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: A2LD1 Antibody [NBP2-38064] - Staining in human kidney and lymph node tissues using anti-GGACT antibody. Corresponding GGACT RNA-seq data are presented for the same tissues.

Applications for A2LD1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: A2LD1

Alternate Names

AIG2-like domain 1, AIG2-like domain-containing protein 1, gamma-glutamylamine cyclotransferase, gamma-glutamylaminecyclotransferase, GGACT

Gene Symbol

GGACT

UniProt

Additional A2LD1 Products

Product Documents for A2LD1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for A2LD1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...