Peptide YY (3-36) human

Name: Peptide YY (3-36) human
Brand: Tocris Bioscience
SKU: 6288

Tocris Bioscience, part of Bio-Techne | Catalog # 6288

COA / SDS

NPY Y2 receptor agonist

Discontinued Product

6288 has been discontinued. View all NPY Receptor Agonists products.

Key Product Details

Description:	NPY Y₂ receptor agonist
Purity:	≥95% (HPLC)
Molecular Weight:	4049.51

View Full Technical Details for Peptide YY (3-36) human

Technical Data
Citations

Biological Activity for Peptide YY (3-36) human

Peptide YY (3-36) human is a NPY Y₂ receptor agonist. Peripheral administration inhibits food intake in mice. This effect is greater when Peptide YY (3-36) is administered in combination with GLP-1 (7-36) (Cat.No. 2082).

Technical Data for Peptide YY (3-36) human

M. Wt	4049.51
Formula	C₁₈₀H₂₇₉N₅₃O₅₄
Single Letter Sequence	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	123583-37-9
PubChem ID	71581482
InChi Key	AUHJXHCVECGTKR-RIBGVNDISA-N
Smiles	[H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Peptide YY (3-36) human

References are publications that support the biological activity of the product.

Neary Peptide YY3-36 and glucagon-like peptide-17-36 inhibit food intake additively Endocrinology. 2005 PMID: 16150917
Batterham Gut hormone PYY(3-36) physiologically inhibits food intake. Nature 2002 PMID: 12167864

Peptide YY (3-36) human

Tocris Bioscience, part of Bio-Techne | Catalog # 6288

Key Product Details

Biological Activity for Peptide YY (3-36) human

Technical Data for Peptide YY (3-36) human

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Peptide YY (3-36) human

Product Documents for Peptide YY (3-36) human

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected