Skip to main content

Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90305PEP

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP1-90305PEP has been discontinued. View all Serpin F2/alpha 2-Antiplasmin products.

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINF2.

Source: E. coli

Amino Acid Sequence: VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90305PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Serpin F2/alpha 2-Antiplasmin

Identification in human milk of complexes of matriptase with ATIII, A1AT, or A2AP, provides evidence that the proteolytic activity of matriptase, from cells that express no or low levels of HAI-1, may be controlled by secreted serpins. Sequencing analysis revealed the presence of two alpha2-PI gene variations, both in the second half of exon 10: a frameshift mutation and a G to A transition at nucleotide 11337 in codon 407. Observational study of gene-disease association. (HuGE Navigator). Thrombin activatable fibrinolysis inhibitor and alpha(2)-antiplasmin are not markers for recanalization in patients with ischemic stroke treated with recombinant tissue-type plasminogen activator. Fibrinolysis is amplified by converting alpha-antiplasmin from a plasmin inhibitor to a substrate. Hydroxyethyl starch (HES) dilution enhances fibrinolysis by diminishing alpha2-antiplasmin-plasmin interactions. the Arg6Trp polymorphism may play a significant role in governing the long-term deposition/removal of intravascular fibrin. TAFIa, PAI-1 and alpha-antiplasmin: complementary roles in regulating lysis of thrombi and plasma clots. Alpha2-antiplasmin has an important role in acute pulmonary embolism. Multiple Lys residues within alpha 2-antiplasmin contribute, perhaps in a zipper-like fashion, to its binding to the in-tandem, multikringle array that configures the plasmin heavy chain. alpha2-antiplasmin induction inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion

Alternate Names

alpha 2-Antiplasmin

Gene Symbol

SERPINF2

Additional Serpin F2/alpha 2-Antiplasmin Products

Product Documents for Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...