Skip to main content

SLC7A13 Antibody

Catalog # NBP3-10159 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-10159-100ul

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for SLC7A13 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of rat SLC7A13 (NP_001012100). Peptide sequence MAMDIEKKIYLKRQLGYFWGTNFLIINIIGAGIFVSPKGVLQYSSMNVGV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC7A13 Antibody

Western Blot: SLC7A13 Antibody [NBP3-10159] - Western blot analysis of SLC7A13 in Rat Skeletal Muscle lysates. Antibody dilution at 1ug/ml

Applications for SLC7A13 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC7A13

SLC7A13 mediates the transport L-aspartate and L-glutamate in a sodium-independent manner

Alternate Names

AGT1, AGT-1, solute carrier family 7 (anionic amino acid transporter), member 13, solute carrier family 7 member 13, XAT2

Gene Symbol

SLC7A13

Product Documents for SLC7A13 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC7A13 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...