Skip to main content

SGK3 Antibody [Alexa Fluor® 700]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38447AF700

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-38447AF700 has been discontinued. View all SGK3 products.

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Alexa Fluor 700 (Excitation = 675-700 nm, Emission = 723 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SGK3 (NP_037389.4).

Sequence:
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for SGK3 Antibody [Alexa Fluor® 700]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: SGK3

SGKL/SGK3, also known as CISK for cytokine-independent survival kinase, is a SGK type protein kinase. The protein contains a lipid-binding phox homology (PX) domain, which is required for targeting SGKL/SGK3 protein to the endosomal compartment. SGKL/SGK3 functions downstream of the phosphoinositide 3-kinase (PI3K) cascade and has been implicated in cell survival. The protein has been shown to be phosphorylated and activated by 3-phosphoinositide-dependent protein kinase 1 (PDK1), and to a lesser extent insulin-like growth factor-1, in vitro. Activated SGKL/SGK3 has been shown to phosphorylate glycogen synthase kinase 3 beta (GSK-3beta) in vitro. SGKL/SGK3 expression has been documented in many human tissues but was found to be most abundant in lung. ESTs have been isolated from human tissue libraries, including normal liver, breast and thyroid and cancerous spleen, ear and pancreas.

Long Name

Serum/Glucocorticoid Regulated Kinase 3

Alternate Names

CISK

Gene Symbol

SGK3

Additional SGK3 Products

Product Documents for SGK3 Antibody [Alexa Fluor® 700]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SGK3 Antibody [Alexa Fluor® 700]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...