Skip to main content

Pea3 Antibody [Alexa Fluor® 350]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35390AF350

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-35390AF350 has been discontinued. View all Pea3 products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Alexa Fluor 350 (Excitation = 346 nm, Emission = 442 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant Protein corresponding to a sequence within amino acids 1-284 of human Pea3 (NP_001977.1).

Sequence:
KNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for Pea3 Antibody [Alexa Fluor® 350]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Pea3

Pea3, also known as ETS translocation variant 4, is an approximately 54 kDa, 484 amino acid protein, which is involved in transcriptional activation of adenovirus E1A gene, and is regulated by ERBB2, STK11, PLAG1, CTNNB1. Studies about the Pea3 protein are being done on diseases such as ovaria, pancreatic, gastric, breast, and prostate cancers. As well as peripheral primitive neuroectodermal tumors, carcinoma, adenoma, ewings sarcoma, squamous cell carcinoma, and oral cancers. The Pea3 protein has shown interaction with Taf7, EP300, SRF, HOXD4, STK11, and involvement in the ErbB2-ErbB3 Heterodimer pathway.

Alternate Names

Adenovirus E1A enhancer-binding protein, E1A-FE1A enhancer binding protein, E1AFETS translocation variant 4, ets variant 4, ets variant gene 4 (E1A enhancer binding protein, E1AF), ets variant gene 4 (E1A enhancer-binding protein, E1AF), EWS protein/E1A enhancer binding protein chimera, PEA3, PEAS3, Polyomavirus enhancer activator 3 homolog, polyomavirus enhancer activator-3, Protein PEA3

Gene Symbol

ETV4

Additional Pea3 Products

Product Documents for Pea3 Antibody [Alexa Fluor® 350]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Pea3 Antibody [Alexa Fluor® 350]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...