Skip to main content

Leukotriene B4 R1 Antibody (4R2X8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15458

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-15458 has been discontinued. View all Leukotriene B4 R1 products.

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4R2X8

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 253-352 of human Leukotriene B4 R1 (Q15722). AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Leukotriene B4 R1 Antibody (4R2X8)

Western Blot: Leukotriene B4 R1 Antibody (4R2X8) [NBP3-15458]

Western Blot: Leukotriene B4 R1 Antibody (4R2X8) [NBP3-15458]

Western Blot: Leukotriene B4 R1 Antibody (4R2X8) [NBP3-15458] - Western blot analysis of extracts of various cell lines, using Leukotriene B4 R1 antibody (NBP3-15458) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Leukotriene B4 R1 Antibody (4R2X8) [NBP3-15458]

Western Blot: Leukotriene B4 R1 Antibody (4R2X8) [NBP3-15458]

Western Blot: Leukotriene B4 R1 Antibody (4R2X8) [NBP3-15458] - Western blot analysis of extracts of various cell lines, using Leukotriene B4 R1 antibody (NBP3-15458) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Leukotriene B4 R1 Antibody (4R2X8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Leukotriene B4 R1

BLTR2, also known as Leukotriene B4 Receptor 1, is a Chemoattractant Receptor that causes LTB4-induced chemotaxis, calcium mobilization, and inhibition of adenylyl cyclase. Portions of the coding regions of BLTR2 have been duplicated and are part of the 5' UTR noncoding regions of the clusters LS190955 (BLT1) and LS54843 (CIDE-B) on chromosome 14. BLTR2 has been reported in humans in peripheral blood leukocytes, mononuclear lymphocytes, and spleen. ESTs have been isolated from a broad array of human libraries, including brain, eye, fetal lung/testis/B-cell, heart, kidney, melanocyte/uterus/fetal heart, testis, tonsil, and uterus libraries

Long Name

Leukotriene B4 Receptor 1

Alternate Names

BLT1, Leukotriene B4R1, LTB4R, LTB4R1

Gene Symbol

LTB4R

Additional Leukotriene B4 R1 Products

Product Documents for Leukotriene B4 R1 Antibody (4R2X8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Leukotriene B4 R1 Antibody (4R2X8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...