Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16556

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-16556 has been discontinued. View all Isocitrate Dehydrogenase 1/IDH1 products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5S2U7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Isocitrate Dehydrogenase 1/IDH1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Isocitrate Dehydrogenase 1/IDH1 (NP_005887.2). RNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7)

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7) [NBP3-16556]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7) [NBP3-16556]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody (3L6P2) [NBP3-16556] - Western blot analysis of extracts of various cell lines, using Isocitrate Dehydrogenase 1/IDH1 Rabbit mAb (NBP3-16556) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunoprecipitation: Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7) [NBP3-16556]

Immunoprecipitation: Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7) [NBP3-16556]

Immunoprecipitation: Isocitrate Dehydrogenase 1/IDH1 Antibody (3L6P2) [NBP3-16556] - Immunoprecipitation analysis of 600ug extracts of Mouse brain using 3ug Isocitrate Dehydrogenase 1/IDH1 antibody (NBP3-16556). Western blot was performed from the immunoprecipitate using Isocitrate Dehydrogenase 1/IDH1 antibody (NBP3-16556) at a dilition of 1:1000.

Applications for Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Isocitrate Dehydrogenase 1/IDH1

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq]

Alternate Names

IDCD, IDH1, IDP, IDPC, PICD

Gene Symbol

IDH1

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Product Documents for Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Isocitrate Dehydrogenase 1/IDH1 Antibody (5S2U7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.