Skip to main content

GPT Antibody [Alexa Fluor® 700]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38016AF700

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-38016AF700 has been discontinued. View all GPT products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Alexa Fluor 700 (Excitation = 675-700 nm, Emission = 723 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GPT (NP_005300.1).

Sequence:
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for GPT Antibody [Alexa Fluor® 700]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: GPT

GPT, also known as Alanine aminotransferase 1, is a 496 amino acid that is 55 kDa, cytoplasm located, most commonly found in liver, kidney, heart, and skeletal muscles; acts as a catalyzer of the reversible transamination between alanine and 2-oxoglutarate to compose pyruvate and glutamate, is involved in cellular nitrogen metabolism, and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Current research is being performed on several diseases and disorders including vitelliform macular dystrophy, liver disease, epidemic typhus, pyomyositis, kidney cortex necrosis, scrub typhus, hepatitis e, hepatitis c, iron overload hepatitis b, glucose intolerance, biliary atresia, alcohol abuse, cholangitis, cholecystitis, hellp syndrome, viral hepatitis, siderosis, choledocholithiasis, hepatitis a, kawasaki disease, wilson disease, and hepatic encephalopathy. This protein has shown to have interactions with CAPN1, CAPN3, HSPD1, THNSL2, GPT2, AND PSAT1 in pathways such as alanine, aspartate and glutamate metabolism, amino acid synthesis and interconversion (transamination), and metabolism of amino acids and derivatives.

Alternate Names

AAT1alanine aminotransferase 1, ALT1, ALT1EC 2.6.1.2, Glutamate pyruvate transaminase 1, glutamic-alanine transaminase 1, Glutamic--alanine transaminase 1, glutamic-pyruvate transaminase (alanine aminotransferase), Glutamic--pyruvic transaminase 1, GPT1GPT 1

Gene Symbol

GPT

Additional GPT Products

Product Documents for GPT Antibody [Alexa Fluor® 700]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GPT Antibody [Alexa Fluor® 700]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...