Fibrinopeptide B Antibody [DyLight 594]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35409DL594

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-35409DL594 has been discontinued. View all Fibrinopeptide B products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

DyLight 594 (Excitation = 593 nm, Emission = 618 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Fibrinopeptide B Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).

Sequence:
QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for Fibrinopeptide B Antibody [DyLight 594]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Fibrinopeptide B

The protein encoded by the Fibrinopeptide B gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of threepairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrinwhich is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrinregulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for severalcell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia,hypodysfibrinogenemia and thrombotic tendency. (provided by RefSeq)

Alternate Names

Beta-Fibrinogen, FGB Peptide, FIBB, Fibrinogen beta chain, Fibrinogen Type II, FPB

Gene Symbol

FGB

Additional Fibrinopeptide B Products

Product Documents for Fibrinopeptide B Antibody [DyLight 594]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Fibrinopeptide B Antibody [DyLight 594]



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.