EIF3B Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87342

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP2-87342 has been discontinued. View all EIF3B products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all EIF3B Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EIF3B. Peptide sequence: ENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit EIF3B Antibody - BSA Free (NBP2-87342) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for EIF3B Antibody - BSA Free

Western Blot: EIF3B Antibody [NBP2-87342]

Western Blot: EIF3B Antibody [NBP2-87342]

Western Blot: EIF3B Antibody [NBP2-87342] - Host: Rabbit. Target Name: EIF3B. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for EIF3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF3B

Eukaryotic initiation factor 3 subunit B (eIF3B) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3B is a conserved subunit and part of the functional core of eIF3. It bears a non-canonical RNA recognition motif (RRM) and interacts directly with the eIF3S1 subunit.

Alternate Names

eIF3 p110, eIF3 p116, eIF3b, eIF-3-eta, EIF3-P110, EIF3-P116, EIF3S9EIF3-ETA, Eukaryotic translation initiation factor 3 subunit 9, eukaryotic translation initiation factor 3 subunit B, eukaryotic translation initiation factor 3, subunit 9 (eta, 116kD), eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, eukaryotic translation initiation factor 3, subunit B, MGC104664, MGC131875, Prt1 homolog, PRT1hPrt1

Gene Symbol

EIF3B

Additional EIF3B Products

Product Documents for EIF3B Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EIF3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.