Skip to main content

SRC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57610PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57610PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRC1.

Source: E. coli

Amino Acid Sequence: PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57610PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SRC1

Steroid and thyroid hormones and retinoic acid regulate a complex array of gene expression activity via intracellular receptor transcription factors belonging to the ligand dependent nuclear receptor superfamily. Adding to the complexity of function of these transcription factors are associated proteins known as coactivators and corepressors which, as their names suggest, enhance or depress transcriptional activity of the nuclear receptor with which they associate. One such coactivator is Steroid Receptor Coactivator-1 (SRC 1).SRC 1 has been shown to interact with and stimulate the transcriptional activity of estrogen, progesterone, retinoic acid, thyroid and glucocorticoid receptors, as well as retinoic X receptor (RXR) in a ligand dependent manner. The amino terminal region of SRC 1 contains a PAS-A-basic helix-loop-helix homology domain which has previously been shown to be dimerization domains in other nuclear transcription factors including the aryl hydrocarbon (Ah) receptor and its heterodimerization partner, ARNT. The carboxy-terminal region of SRC 1 has been shown to possess histone acetyltransferase activity specific primarily for histones H3 & H4.

Long Name

Nuclear receptor coactivator 1

Alternate Names

bHLHe74, NCoA-1, NCOA1, Protein Hin-2, RIP160

Gene Symbol

NCOA1

Additional SRC1 Products

Product Documents for SRC1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SRC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...