Skip to main content

PTTG1IP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57370PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57370PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTTG1IP.

Source: E. coli

Amino Acid Sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57370.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57370PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PTTG1IP

PTTG1IP, also known as Pituitary tumor-transforming gene 1 protein-interacting protein, is a 180 amino-acid protein that is 20 kDa, and may facilitate PTTG1 nuclear translocation and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. Disease research is currently being performed with relation to this protein and pituitary tumor intrahepatic cholangiocarcinoma, pituitary adenoma, cholangiocarcinoma, adenoma astrocytoma, breast cancer, and thyroiditis. PTTG1IP protein involvement has been observed with relation to PTTG1, UBC and RAB4A in protein import into nucleus pathways.

Alternate Names

C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein, PBFPTTG-binding factor, pituitary tumor-transforming 1 interacting protein, Pituitary tumor-transforming gene protein-binding factor

Gene Symbol

PTTG1IP

Additional PTTG1IP Products

Product Documents for PTTG1IP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTTG1IP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...