Skip to main content

PTH1R/PTHR1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16996PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16996PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTH1R/PTHR1

Source: E. coli

Amino Acid Sequence: FLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16996.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-16996PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PTH1R/PTHR1

PTHR1, a Parathyroid Hormone Receptor, mediates PTH-dependent regulation of mineral-ion homeostasis. It also mediates the paracrine action of PTHRP in endochondral bone formation. Mutations in this receptor are responsible for disorders of calcium and bone metabolism such as chondrodysplasia, hypercalcemia, and chronic renal failure. Three promoters, P1, P2, and P3, regulate the expression of PTHR. PTHR1 has been reported to be expressed in bone, breast, brain, colon, GI, kidney, liver, placenta, skin, umbilical cord, and uterus. ESTs have been isolated from B-cell/lung/testis, brain, breast, fetus, heart, heart/melanocyte/uterus, kidney, liver/spleen, lung, placenta, and testis libraries.

Long Name

Parathyroid Hormone Receptor 1

Alternate Names

PTHR, PTHR1

Gene Symbol

PTH1R

Additional PTH1R/PTHR1 Products

Product Documents for PTH1R/PTHR1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTH1R/PTHR1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...