Skip to main content

delta 2 Catenin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47487PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-47487PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTNND2.

Source: E. coli

Amino Acid Sequence: ASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTGLELVDSCIRSLQESGILDPQDYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLALGETTPSQLPARGTQARATGQSFSQGTTSRA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47487.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-47487PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: delta 2 Catenin

Delta-Catenin, is a member of the p120 catenin subfamily of catenins. Delta-Catenin/NPRAP was identified as a protein homologous to plakophilin 1 and as a protein interacting with the loop region of presenilin 1 (PS1), the gene most commonly mutated in Alzheimer's disease. Delta-Catenin/NPRAP is almost exclusively expressed in the central nervous system mainly during early brain development. Delta-Catenin/NPRAP has been shown to co-localize and interact with N-cadherin in the mouse brain and to undergo dynamic relocalization during brain development.

Alternate Names

catenin (cadherin-associated protein), delta 2 (neural plakophilin-relatedarm-repeat protein), catenin delta-2, Delta-catenin, GT24T-cell delta-catenin, Neural plakophilin-related ARM-repeat protein, Neurojungin, NPRAPneurojungin

Gene Symbol

CTNND2

Additional delta 2 Catenin Products

Product Documents for delta 2 Catenin Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for delta 2 Catenin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...