Skip to main content

Acyloxyacyl Hydrolase Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33892PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33892PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AOAH.

Source: E. coli

Amino Acid Sequence: QLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33892.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33892PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Acyloxyacyl Hydrolase

Acyloxyacyl Hydrolase, also known as AOAH, contains a 65 kDa and a 62 kDa isoform, and is involved in the detoxification of bacterial lipopolysaccharides by eliminating fatty acyl chains from the molecule. Current research is being conducted on Acyloxyacl Hydrolase and its relation to the common cold, hepatitis, gastric cancer, osteochondrosis, asthma, and mastitis. The protein is linked to inflammatory responses and lipid metabolic process where it interacts with IGHG1.

Alternate Names

acyloxyacyl hydrolase, acyloxyacyl hydrolase (neutrophil), EC 3.1.1.77

Gene Symbol

AOAH

Additional Acyloxyacyl Hydrolase Products

Product Documents for Acyloxyacyl Hydrolase Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acyloxyacyl Hydrolase Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...