Skip to main content

GOLGA7B Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-56754

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-56754

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GOLGA7B Antibody - BSA Free

Western Blot: GOLGA7B Antibody [NBP1-56754]

Western Blot: GOLGA7B Antibody [NBP1-56754]

Western Blot: GOLGA7B Antibody [NBP1-56754] - 721_B cell lysate, concentration 0.2-1 ug/ml.
GOLGA7B Antibody - BSA Free

Western Blot: GOLGA7B Antibody - BSA Free [NBP1-56754] -

Identification of key genes related to CCA patient survival. (A) The forest plot shows the six survival-related genes in the yellow module identified by univariate Cox regression analysis. (B) Forest plot showing that GOLGA7B and AGAP2−AS1 were independent survival-related genes determined through multivariate Cox regression analysis. (C) Kaplan–Meier curves showing that CCA patients with higher expression of GOLGA7B had a high survival probability, and those with a higher expression of AGAP2−AS1 had a lower survival probability. (D) mRNA expression of GOLGA7B and AGAP2−AS1 between tumor and normal tissues in CCA patients in the training group. (E) Analysis of Human Protein Atlas database indicated that GOLGA7B protein expression was significantly upregulated in CCA tumor tissues compared with cholangiocytes. The CCA tumor tissue came from a 67-year-old man (patient ID: 3334; staining: medium; quantity: 25%-75%; intensity: moderate). The normal tissue came from a 55-year-old man (patient ID: 2399; staining: not detected; quantity:<25%; intensity: weak). (F) qRT-PCR confirmed that GOLGA7B and AGAP2−AS1 were overexpressed in tumor samples compared to normal tissue samples. (G) Western blotting confirmed that the protein expression of GOLGA7B was significantly upregulated in tumor samples compared with normal tissue samples. * P<0.05; *** P<0.001; **** P<0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36591499), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GOLGA7B Antibody - BSA Free

Western Blot: GOLGA7B Antibody - BSA Free [NBP1-56754] -

Identification of the biological functions of GOLGA7B and AGAP2−AS1 in CCA. (A) Knockdown of GOLGA7B and AGAP2−AS1 in RBE and HuCCT-1 cells was confirmed at the mRNA level by qRT-PCR. (B) Knockdown of GOLGA7B in RBE and HuCCT-1 cells was confirmed at the protein level by Western blotting. (C) The CCK-8 assay verified the proliferation of RBE and HuCCT-1 cells after GOLGA7B and AGAP2−AS1 depletion. (D) Transwell assays were performed to measure the migration and invasion capabilities of RBE and HuCCT-1 cells after GOLGA7B and AGAP2−AS1 depletion. ** P<0.01; *** P<0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36591499), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GOLGA7B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GOLGA7B

The exact function of C10orf132 remains unknown.

Alternate Names

bA451M19.3, bA459F3.4, C10orf132, C10orf133, chromosome 10 open reading frame 132, chromosome 10 open reading frame 133, golgi autoantigen, golgin subfamily a, 7B, golgin A7 family, member B, Golgin subfamily A member 7B, MGC131701

Gene Symbol

GOLGA7B

UniProt

Additional GOLGA7B Products

Product Documents for GOLGA7B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GOLGA7B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...