SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-90967CL1
![SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]](https://resources.bio-techne.com/images/products/nbp2-90967cl1_mouse-sars-nucleocapsid-protein-mab-ap201054-cl1-8920251546569.png "Product Feature: CoraFluor Probes for TR-FRET")
Conjugate
Catalog #
Forumulation
Catalog #
Key Product Details
Species Reactivity
SARS-CoV, SARS-CoV-2
Applications
Western Blot, ELISA, Immunoassay, Direct ELISA, Immunocytochemistry/ Immunofluorescence
Label
CoraFluor 1
Antibody Source
Monoclonal Mouse IgG Clone # AP201054
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Reactivity Notes
Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).
Clonality
Monoclonal
Host
Mouse
Isotype
IgG
Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Scientific Data Images for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Product Feature: CoraFluor Probes for TR-FRET
CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.Applications for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Application
Recommended Usage
Direct ELISA
Optimal dilutions of this antibody should be experimentally determined.
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunoassay
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP2-90967. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.
Formulation, Preparation, and Storage
Purification
Protein G purified
Formulation
PBS
Preservative
No Preservative
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark. Do not freeze.
Background: SARS Nucleocapsid Protein
Alternate Names
N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome
Gene Symbol
N
Additional SARS Nucleocapsid Protein Products
Product Documents for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Product Specific Notices for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]
Sold for research purposes only under agreement from Massachusetts General Hospital, US Patent No. 12,134,721. A license is required for development of new commercial assay platforms (e.g., microarrays, microfluidics), diagnostic use or other unlicensed uses. Please contact Technical Support for further details: techsupport@bio-techne.com.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...