Skip to main content

VISTA/B7-H5/PD-1H Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88967PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-88967PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C10ORF54.

Source: E. coli

Amino Acid Sequence: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88967.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88967PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: VISTA/B7-H5/PD-1H

VISTA (V-domain immunoglobulin suppressor of T cell activation) is a cell surface coinhibitory protein belonging to the CD28/B7 family. VISTA can act as both a ligand and a receptor in regulating T cell activity. VISTA is expressed on dendritic cells, monocytes, and both CD4+ and CD8+ T cells. VISTA functions as an inhibitory receptor downregulating CD4+ and CD8+ T cell proliferation and exhibiting a protective effect in mice from graft versus host disease, asthma, and acute hepatitis. VISTA also acts as a ligand on antigen presenting cells. Two cell surface expressed proteins VSIG-3 and PSGL-1 have been identified as binding partners of VISTA. Immune checkpoint proteins like the VISTA protein are often overexpressed by cancer cells or surrounding cells in the tumor microenvironment. VISTA upregulation occurs on tumor-infiltrating leukocytes and is expressed on several cancer types including melanoma, lung, ovarian, colon, prostate, and pancreatic cancer. Further, knockout and blocking antibody studies of VISTA have shown an increase in T cell responses in several mouse tumor models making VISTA a potential therapeutic target alone or in combination with other known immune checkpoint inhibitors. Alternative names of VISTA include PD-1H, Gi24, Dies1, and SISP1.

Alternate Names

4632428N05Rik, B7-H5, C10orf54, Dies1, Gi24, PD-1H, PD1H, SISP1, VSIR

Gene Symbol

VSIR

Additional VISTA/B7-H5/PD-1H Products

Product Documents for VISTA/B7-H5/PD-1H Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VISTA/B7-H5/PD-1H Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...