TSLPR/CRLF2 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25208PEP
Key Product Details
Conjugate
Applications
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: YRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP3-25208PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: TSLPR
TSLPR, also known as Delta and CRLM-2, is expressed on regulatory T cells (Treg), some subsets of helper T cells, innate lymphoid cells (ILC), monocytes, and dendritic cells. It associates with IL-7R alpha to form a high affinity receptor complex for epithelium-derived TSLP (thymic stromal lymphopoeitin). TSLP is a homeostatic cytokine that induces the release of T cell-attracting chemokines and enhances the maturation of CD1c+ dendritic cells.
Long Name
Alternate Names
Gene Symbol
Additional TSLPR Products
Product Documents for TSLPR/CRLF2 Recombinant Protein Antigen
Product Specific Notices for TSLPR/CRLF2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.